Computational Biology Labortory, National Yang Ming Chiao Tung University
Computational Biology Labortory, China Medical University
Cu2+ binding sites prediction results for "Job at 2021-02-05 06:49:22"
Help For Safari User +
1. In Safari, open the "Safari" menu and select "Preferences".
2. Then, click the "Advanced" tab in the "Preferences" window.
3. Then, at the bottom of the window, check the "Show Develop menu in menu bar" checkbox.
4. Then, open the "Develop" menu in the menu bar and select "Enable WebGL".
Help For Chrome User +
1. In Chrome, Type "chrome://flags" in the address bar.
2. Press Ctrl + f and type "Rendering list", "Override software rendering list" should come up, Now click on "Enable" and restart the browser.
3. Restart Chrome for the change to take effect.


Chain
PredictionDocking
No. Binding Residues Template Score Show / DL
1 39H ,  89C ,  92H ,  97M 3tu6A0 4.638 0 /
2 39H ,  89C ,  92H ,  97M 1kdiA0 4.430 1 /
3 39H ,  89C ,  92H ,  97M 5u7nA0 3.924 2 /
4 39H ,  89C ,  92H ,  97M 1ov8D0 3.866 3 /
5 39H ,  89C ,  92H ,  97M 3cg8C1 3.436 4 /
6 39H ,  89C ,  92H 4hcfB0 3.377 5 /
7 39H ,  89C ,  92H ,  97M 1gy1A0 3.342 6 /
8 39H ,  89C ,  92H ,  97M 1jerA0 2.739 7 /
9 39H ,  89C ,  92H ,  97M 6evgA0 2.699 8 /
10 39H ,  89C ,  92H ,  97M 1aozA0 2.393 9 /
11 39H ,  89C ,  92H ,  98V 3c75A0 2.140 10 /
12 39H ,  89C ,  92H ,  97M 3g5wD0 2.025 11 /
Residue Number Amino Acid Score
1 GLU -0.289
2 THR -0.289
3 PHE -0.289
4 THR -0.289
5 VAL -0.289
6 LYS -0.289
7 MET -0.289
8 GLY -0.289
9 ALA -0.289
10 ASP -0.289
11 SER -0.289
12 GLY -0.289
13 LEU -0.289
14 LEU -0.289
15 GLN 1.471
16 PHE -0.289
17 GLU -0.289
18 PRO -0.289
19 ALA -0.289
20 ASN -0.289
21 VAL -0.289
22 THR -0.289
23 VAL -0.289
24 HIS -0.289
25 PRO -0.289
26 GLY -0.289
27 ASP -0.289
28 THR -0.289
29 VAL -0.289
30 LYS -0.289
31 TRP -0.289
32 VAL -0.289
33 ASN -0.289
34 ASN -0.289
35 LYS -0.289
36 LEU -0.289
37 PRO -0.289
38 PRO -0.289
39 HIS 4.638
40 ASN -0.289
41 ILE -0.289
42 LEU -0.289
43 PHE -0.289
44 ASP -0.289
45 ASP 1.121
46 LYS 1.121
47 GLN -0.289
48 VAL -0.289
49 PRO -0.289
50 GLY -0.289
51 ALA -0.289
52 SER -0.289
53 LYS -0.289
54 GLU -0.289
55 LEU -0.289
56 ALA -0.289
57 ASP 0.056
58 LYS -0.289
59 LEU -0.289
60 SER -0.289
61 HIS 0.803
62 SER -0.289
63 GLN 0.803
64 LEU -0.289
65 MET -0.289
66 PHE -0.289
67 SER -0.289
68 PRO -0.289
69 GLY -0.289
70 GLU 0.803
71 SER -0.289
72 TYR -0.289
73 GLU -0.289
74 ILE -0.289
75 THR -0.289
76 PHE -0.289
77 SER -0.289
78 SER -0.289
79 ASP -0.289
80 PHE -0.289
81 PRO -0.289
82 ALA -0.289
83 GLY -0.289
84 THR -0.289
85 TYR -0.289
86 THR -0.289
87 TYR -0.289
88 TYR -0.289
89 CYS 4.638
90 ALA -0.289
91 PRO -0.289
92 HIS 4.638
93 ARG -0.289
94 GLY -0.289
95 ALA -0.289
96 GLY -0.289
97 MET 4.638
98 VAL 2.140
99 GLY -0.289
100 LYS -0.289
101 ILE -0.289
102 THR -0.289
103 VAL -0.289
104 GLU -0.289
105 GLY -0.289

Homology Modeling Results

Query name1baw_A
Seq. length105
SequenceETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
PDB ModelTemplateSeq-lenAligned (%)Identity (%)Bit-scoreE-value
model_1
3cvbA10510099.052193e-58

Alignment
query ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLS
3cvbA ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLS
      *************:**********************************************

query HSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
3cvbA HSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
      *********************************************

Binding Potential